PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN35711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 351aa    MW: 39812.1 Da    PI: 6.8647
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN35711.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-092773131955
                 HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +k +yps++++  LA+++gL+++q+ +WF N+R ++
  KHN35711.1 277 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 313
                 45679*****************************885 PP

2ELK38.22.9e-13233253121
         ELK   1 ELKhqLlrKYsgyLgsLkqEF 21 
                 ELK qLlrKY+gyLgsLkqEF
  KHN35711.1 233 ELKGQLLRKYRGYLGSLKQEF 253
                 9*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012553.6E-20102146IPR005540KNOX1
PfamPF037904.7E-22103142IPR005540KNOX1
SMARTSM012569.9E-24145196IPR005541KNOX2
PfamPF037915.6E-21149195IPR005541KNOX2
SMARTSM011885.9E-7233254IPR005539ELK domain
PROSITE profilePS5121311.139233253IPR005539ELK domain
PfamPF037895.4E-9233253IPR005539ELK domain
PROSITE profilePS5007113.167253316IPR001356Homeobox domain
SMARTSM003891.2E-12255320IPR001356Homeobox domain
SuperFamilySSF466891.8E-19255331IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-28258318IPR009057Homeodomain-like
CDDcd000861.17E-12265317No hitNo description
PfamPF059206.2E-17273312IPR008422Homeobox KN domain
PROSITE patternPS000270291314IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MEGVISSKGM GFGENTSSSG VCPMMMMPLV TSHHVGHHPL NHPILNNPNP NEHTNTLFLP  60
MPCTNNNHHP NRNNHNSNAT ELGYFMEIPN NNNDGSSSSP SSAVKAKIMA HPHYHRLLAA  120
YVNCQKVGAP PEVVGRLEEA CASAAVIMAG EDPALDQFME AYCEMLIKYE QELSKPFKEA  180
MLFLQRIECQ FKSLTISSSL DTTACNEAID RNGPSEDVDV QTNIIDPQAE DQELKGQLLR  240
KYRGYLGSLK QEFTKKRKKG KLPKEARQQL LEWWSRHYKW PYPSESQKLA LAESTGLDQK  300
QINNWFINQR KRHWKPSEDM QFVVVDPSHP HYYMENVLGN PFPMDLSHPM L
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1248257LKQEFTKKRK
2254258KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ8573390.0DQ857339.1 Glycine max KNT1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001237352.10.0KNT1
SwissprotP466081e-162HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0B2RMF60.0A0A0B2RMF6_GLYSO; Homeobox protein SBH1
STRINGGLYMA07G39350.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-129KNOX/ELK homeobox transcription factor
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]